PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN42964.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family B3
Protein Properties Length: 182aa    MW: 20427.6 Da    PI: 8.1987
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN42964.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B342.51.2e-13841334292
                 TS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
          B3  42 sgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                  g+sW++ + y +++++ +  +GWk+Fv +n L++gD ++F+l+++s+++ 
  KHN42964.1  84 GGKSWDMVY-YGQSKQKAFGVTGWKKFVIDNCLRVGDACIFELMESSDKKV 133
                 59*******.777777788889********************997766544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.71E-1443136IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.9E-1244141IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.004946143IPR003340B3 DNA binding domain
CDDcd100171.19E-1184141No hitNo description
PfamPF023621.6E-1184134IPR003340B3 DNA binding domain
PROSITE profilePS5086310.84285143IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MFSRRSSGRV ASGRVALENG VPLPLLPDPK ANLQWDEVKP LSGKPYWHSV LSPTNLQPRY  60
NLMPGMNLRS KLPSNEVPTI LIYGGKSWDM VYYGQSKQKA FGVTGWKKFV IDNCLRVGDA  120
CIFELMESSD KKVILEVQIL RGDIPSEWLG NEMIIGQGNE MIIGQENEMI IGHSRENPIV  180
LN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003529446.11e-132PREDICTED: B3 domain-containing protein Os04g0386900-like isoform X1
RefseqXP_006583943.11e-132PREDICTED: B3 domain-containing protein Os04g0386900-like isoform X1
TrEMBLA0A0B2SFB11e-132A0A0B2SFB1_GLYSO; B3 domain-containing protein
TrEMBLK7L3A11e-132K7L3A1_SOYBN; Uncharacterized protein
STRINGGLYMA07G35040.21e-132(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF97222640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.14e-08B3 family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]